SCOPe 2.04: Domain d2ahkb_: 2ahk B:

Lineage for d2ahkb_ (2ahk B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily)
   2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386

4. Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (1 family)
   Pfam PF06236

5. Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (1 protein)

6. Protein Tyrosinase cofactor MelC1 [254410] (1 species)

7. Species Streptomyces castaneoglobisporus [TaxId:79261] [254849] (22 PDB entries)

8. Domain d2ahkb_: 2ahk B: [241231]
   Other proteins in same PDB: d2ahka_
   complexed with cu, no3

Details for d2ahkb_

PDB Entry: 2ahk, 1.71 Å

PDB Description: Crystal structure of the met-form of the copper-bound Streptomyces castaneoglobisporus tyrosinase in complex with a caddie protein obtained by soking in cupric sulfate for 6 months

PDB Compounds: (B:) caddie protein orf378

SCOPe Domain Sequences for d2ahkb_:

Sequence, based on SEQRES records:

>d2ahkb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpargaahhhehgggyevfvdgvqlhvmrnadgswisvvshyd
pvptpraaaraavdelqgapllp

Sequence, based on observed residues (ATOM records):

>d2ahkb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpagyevfvdgvqlhvmrnadgswisvvshydpvptpraaara
avdelqgapllp

Timeline for d2ahkb_:

• d2ahkb_ is new in SCOPe 2.04-stable
  
• d2ahkb_ appears in SCOPe 2.05
  
• d2ahkb_ appears in the current release, SCOPe 2.08