Lineage for d2ahkb_ (2ahk B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1948851Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily)
    2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386
  4. 1948852Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (1 family) (S)
    Pfam PF06236
  5. 1948853Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (1 protein)
  6. 1948854Protein Tyrosinase cofactor MelC1 [254410] (1 species)
  7. 1948855Species Streptomyces castaneoglobisporus [TaxId:79261] [254849] (22 PDB entries)
  8. 1948875Domain d2ahkb_: 2ahk B: [241231]
    Other proteins in same PDB: d2ahka_
    complexed with cu, no3

Details for d2ahkb_

PDB Entry: 2ahk (more details), 1.71 Å

PDB Description: Crystal structure of the met-form of the copper-bound Streptomyces castaneoglobisporus tyrosinase in complex with a caddie protein obtained by soking in cupric sulfate for 6 months
PDB Compounds: (B:) caddie protein orf378

SCOPe Domain Sequences for d2ahkb_:

Sequence, based on SEQRES records: (download)

>d2ahkb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpargaahhhehgggyevfvdgvqlhvmrnadgswisvvshyd
pvptpraaaraavdelqgapllp

Sequence, based on observed residues (ATOM records): (download)

>d2ahkb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpagyevfvdgvqlhvmrnadgswisvvshydpvptpraaara
avdelqgapllp

SCOPe Domain Coordinates for d2ahkb_:

Click to download the PDB-style file with coordinates for d2ahkb_.
(The format of our PDB-style files is described here.)

Timeline for d2ahkb_: