Lineage for d1g7yd_ (1g7y D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1532834Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1532994Protein Legume lectin [49904] (23 species)
  7. 1533099Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)
  8. 1533103Domain d1g7yd_: 1g7y D: [24113]
    complexed with ca, mn

Details for d1g7yd_

PDB Entry: 1g7y (more details), 2.5 Å

PDB Description: the crystal structure of the 58kd vegetative lectin from the tropical legume dolichos biflorus
PDB Compounds: (D:) stem/leaf lectin db58

SCOPe Domain Sequences for d1g7yd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7yd_ b.29.1.1 (D:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]}
adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddstte
pldiasylvrnvl

SCOPe Domain Coordinates for d1g7yd_:

Click to download the PDB-style file with coordinates for d1g7yd_.
(The format of our PDB-style files is described here.)

Timeline for d1g7yd_: