![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein Legume lectin [49904] (23 species) |
![]() | Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries) |
![]() | Domain d1g7yd_: 1g7y D: [24113] complexed with ca, mn |
PDB Entry: 1g7y (more details), 2.5 Å
SCOPe Domain Sequences for d1g7yd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g7yd_ b.29.1.1 (D:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddstte pldiasylvrnvl
Timeline for d1g7yd_: