Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein automated matches [190442] (12 species) not a true protein |
Species Rice (Oryza sativa) [TaxId:4530] [254945] (1 PDB entry) |
Domain d1wmja_: 1wmj A: [240902] automated match to d2vm1c_ |
PDB Entry: 1wmj (more details)
SCOPe Domain Sequences for d1wmja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wmja_ c.47.1.1 (A:) automated matches {Rice (Oryza sativa) [TaxId: 4530]} maaeegvviachnkdefdaqmtkakeagkvviidftaswcgpcrfiapvfaeyakkfpga vflkvdvdelkevaekynveamptflfikdgaeadkvvgarkddlqntivkhvgataasa sa
Timeline for d1wmja_: