Lineage for d1wmja_ (1wmj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876445Protein automated matches [190442] (13 species)
    not a true protein
  7. 2876516Species Rice (Oryza sativa) [TaxId:4530] [254945] (1 PDB entry)
  8. 2876517Domain d1wmja_: 1wmj A: [240902]
    automated match to d2vm1c_

Details for d1wmja_

PDB Entry: 1wmj (more details)

PDB Description: solution structure of thioredoxin type h from oryza sativa
PDB Compounds: (A:) Thioredoxin H-type

SCOPe Domain Sequences for d1wmja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmja_ c.47.1.1 (A:) automated matches {Rice (Oryza sativa) [TaxId: 4530]}
maaeegvviachnkdefdaqmtkakeagkvviidftaswcgpcrfiapvfaeyakkfpga
vflkvdvdelkevaekynveamptflfikdgaeadkvvgarkddlqntivkhvgataasa
sa

SCOPe Domain Coordinates for d1wmja_:

Click to download the PDB-style file with coordinates for d1wmja_.
(The format of our PDB-style files is described here.)

Timeline for d1wmja_: