Lineage for d1wmja_ (1wmj A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. Protein automated matches [190442] (13 species)
    not a true protein
  7. Species Rice (Oryza sativa) [TaxId:4530] [254945] (1 PDB entry)
  8. Domain d1wmja_: 1wmj A: [240902]
    automated match to d2vm1c_

Details for d1wmja_

PDB Entry: 1wmj (more details)

PDB Description: Solution structure of Thioredoxin type h from Oryza sativa
PDB Compounds: (A:) Thioredoxin H-type

SCOPe Domain Sequences for d1wmja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmja_ c.47.1.1 (A:) automated matches {Rice (Oryza sativa) [TaxId: 4530]}
maaeegvviachnkdefdaqmtkakeagkvviidftaswcgpcrfiapvfaeyakkfpga
vflkvdvdelkevaekynveamptflfikdgaeadkvvgarkddlqntivkhvgataasa
sa

SCOPe Domain Coordinates for d1wmja_ are not available.

Timeline for d1wmja_: