![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins) forms homo and heteroheptameric ring structures |
![]() | Protein D1 core SNRNP protein [50184] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50185] (5 PDB entries) |
![]() | Domain d1vu2y_: 1vu2 Y: [240868] Other proteins in same PDB: d1vu24_, d1vu2b_, d1vu2d_, d1vu2f_, d1vu2h_, d1vu2j_, d1vu2l_, d1vu2n_, d1vu2p_, d1vu2r_, d1vu2t_, d1vu2v_, d1vu2x_, d1vu2z_ complexed with so4 complexed with so4 |
PDB Entry: 1vu2 (more details), 3.1 Å
SCOPe Domain Sequences for d1vu2y_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vu2y_ b.38.1.1 (Y:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir gnniryfilpdslpldtllvdv
Timeline for d1vu2y_: