SCOPe 2.06: Domain d1vu2i_: 1vu2 I:

Lineage for d1vu2i_ (1vu2 I:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
   forms homo and heteroheptameric ring structures

6. Protein D1 core SNRNP protein [50184] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50185] (5 PDB entries)

8. Domain d1vu2i_: 1vu2 I: [240856]
   Other proteins in same PDB: d1vu24_, d1vu2b_, d1vu2d_, d1vu2f_, d1vu2h_, d1vu2j_, d1vu2l_, d1vu2n_, d1vu2p_, d1vu2r_, d1vu2t_, d1vu2v_, d1vu2x_, d1vu2z_
   complexed with so4
   complexed with so4

Details for d1vu2i_

PDB Entry: 1vu2, 3.1 Å

PDB Description: The 8S snRNP Assembly Intermediate

PDB Compounds: (I:) Small nuclear ribonucleoprotein Sm D1

SCOPe Domain Sequences for d1vu2i_:

Sequence; same for both SEQRES and ATOM records:

>d1vu2i_ b.38.1.1 (I:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
gnniryfilpdslpldtllvdv

Timeline for d1vu2i_:

• d1vu2i_ first appeared in SCOPe 2.04
  
• d1vu2i_ appears in SCOPe 2.05
  
• d1vu2i_ appears in SCOPe 2.07
  
• d1vu2i_ appears in the current release, SCOPe 2.08