|  | Class b: All beta proteins [48724] (178 folds) | 
|  | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology | 
|  | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)  | 
|  | Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 | 
|  | Protein D1 core SNRNP protein [50184] (4 species) | 
|  | Species Human (Homo sapiens) [TaxId:9606] [50185] (11 PDB entries) | 
|  | Domain d1vu2q_: 1vu2 Q: [240862] Other proteins in same PDB: d1vu24_, d1vu2b_, d1vu2c_, d1vu2d_, d1vu2f_, d1vu2h_, d1vu2j_, d1vu2k_, d1vu2l_, d1vu2n_, d1vu2p_, d1vu2r_, d1vu2s_, d1vu2t_, d1vu2v_, d1vu2x_, d1vu2z_ complexed with so4 complexed with so4 | 
PDB Entry: 1vu2 (more details), 3.1 Å
SCOPe Domain Sequences for d1vu2q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vu2q_ b.38.1.1 (Q:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
gnniryfilpdslpldtllvdv
Timeline for d1vu2q_: