| Class b: All beta proteins [48724] (178 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
| Protein automated matches [190914] (14 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [196227] (11 PDB entries) |
| Domain d1vu2d_: 1vu2 D: [240852] Other proteins in same PDB: d1vu2a_, d1vu2b_, d1vu2g_, d1vu2i_, d1vu2j_, d1vu2o_, d1vu2q_, d1vu2r_, d1vu2w_, d1vu2y_, d1vu2z_ complexed with so4 complexed with so4 |
PDB Entry: 1vu2 (more details), 3.1 Å
SCOPe Domain Sequences for d1vu2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vu2d_ b.38.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlgevlir
cnnvlyirgve
Timeline for d1vu2d_: