SCOPe 2.08: Domain d1lgc.3: 1lgc E:,F:

Lineage for d1lgc.3 (1lgc E:,F:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Lathyrus ochrus, isolectin II [TaxId:3858] [49911] (2 PDB entries)

8. Domain d1lgc.3: 1lgc E:,F: [24080]
   complexed with ca, mn, mpd

Details for d1lgc.3

PDB Entry: 1lgc, 2.8 Å

PDB Description: interaction of a legume lectin with the n2 fragment of human lactotransferrin or with the isolated biantennary glycopeptide: role of the fucose moiety

PDB Compounds: (E:) legume isolectin II (alpha chain), (F:) legume isolectin II (beta chain)

SCOPe Domain Sequences for d1lgc.3:

Sequence; same for both SEQRES and ATOM records:

>g1lgc.3 b.29.1.1 (E:,F:) Legume lectin {Lathyrus ochrus, isolectin II [TaxId: 3858]}
tettsfsitkfgpdqpnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswklqngkeanvviafngatnvltvsltyp
nXtsytlnevvplkefvpewvrigfsattgaefaahevlswyfnselsv

Timeline for d1lgc.3:

• d1lgc.3 first appeared (with stable ids) in SCOP 1.55
  
• d1lgc.3 appears in SCOPe 2.07