PDB entry 1lgc

View 1lgc on RCSB PDB site
Description: interaction of a legume lectin with the n2 fragment of human lactotransferrin or with the isolated biantennary glycopeptide: role of the fucose moiety
Class: lectin
Keywords: lectin
Deposited on 1994-01-07, released 1994-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.185
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: legume isolectin II (alpha chain)
    Species: Lathyrus ochrus [TaxId:3858]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04122 (0-180)
      • conflict (15)
      • conflict (167)
    Domains in SCOPe 2.07: d1lgc.1
  • Chain 'B':
    Compound: legume isolectin II (beta chain)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lgc.1
  • Chain 'C':
    Compound: legume isolectin II (alpha chain)
    Species: Lathyrus ochrus [TaxId:3858]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04122 (0-180)
      • conflict (15)
      • conflict (167)
    Domains in SCOPe 2.07: d1lgc.2
  • Chain 'D':
    Compound: legume isolectin II (beta chain)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lgc.2
  • Chain 'E':
    Compound: legume isolectin II (alpha chain)
    Species: Lathyrus ochrus [TaxId:3858]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04122 (0-180)
      • conflict (15)
      • conflict (167)
    Domains in SCOPe 2.07: d1lgc.3
  • Chain 'F':
    Compound: legume isolectin II (beta chain)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lgc.3
  • Chain 'H':
    Compound: dipeptide
  • Chain 'I':
    Compound: dipeptide
  • Chain 'J':
    Compound: dipeptide
  • Heterogens: CA, MN, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lgcA (A:)
    tettsfsitkfgpdqpnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswklqngkeanvviafngatnvltvsltyp
    n
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lgcB (B:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfnselsvtsssn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgcB (B:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfnselsvtss
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lgcC (C:)
    tettsfsitkfgpdqpnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswklqngkeanvviafngatnvltvsltyp
    n
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lgcD (D:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfnselsvtsssn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgcD (D:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfnselsv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lgcE (E:)
    tettsfsitkfgpdqpnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswklqngkeanvviafngatnvltvsltyp
    n
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1lgcF (F:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfnselsvtsssn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgcF (F:)
    tsytlnevvplkefvpewvrigfsattgaefaahevlswyfnselsv
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.