Lineage for d1lgc.3 (1lgc E:,F:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12495Protein Lectin [49904] (15 species)
  7. 12596Species Lathyrus ochrus, isolectin II [TaxId:3858] [49911] (2 PDB entries)
  8. 12599Domain d1lgc.3: 1lgc E:,F: [24080]

Details for d1lgc.3

PDB Entry: 1lgc (more details), 2.8 Å

PDB Description: interaction of a legume lectin with the n2 fragment of human lactotransferrin or with the isolated biantennary glycopeptide: role of the fucose moiety

SCOP Domain Sequences for d1lgc.3:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lgc.3 b.29.1.1 (E:,F:) Lectin {Lathyrus ochrus, isolectin II}
tettsfsitkfgpdqpnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswklqngkeanvviafngatnvltvsltyp
nXtsytlnevvplkefvpewvrigfsattgaefaahevlswyfnselsv

SCOP Domain Coordinates for d1lgc.3:

Click to download the PDB-style file with coordinates for d1lgc.3.
(The format of our PDB-style files is described here.)

Timeline for d1lgc.3: