Class a: All alpha proteins [46456] (286 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (27 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [226776] (3 PDB entries) |
Domain d1v1fa_: 1v1f A: [240782] automated match to d1uhna_ complexed with ca, iod, mn, mpd |
PDB Entry: 1v1f (more details), 3 Å
SCOPe Domain Sequences for d1v1fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v1fa_ a.39.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} rppgyedpellasvtpftveevealyelfkklsssiiddglihkeefqlalfrnrnrrnl fadrifdvfdvkrngviefgefvrslgvfhpsapvhekvkfafklydlrqtgfiereelk emvvallheselvlsedmievmvdkafvqadrkndgkididewkdfvslnpsliknmtlp ylkdinrt
Timeline for d1v1fa_: