| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
| Protein automated matches [190513] (36 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [226776] (4 PDB entries) |
| Domain d1v1fa_: 1v1f A: [240782] automated match to d1uhna_ complexed with ca, iod, mn, mpd |
PDB Entry: 1v1f (more details), 3 Å
SCOPe Domain Sequences for d1v1fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v1fa_ a.39.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rppgyedpellasvtpftveevealyelfkklsssiiddglihkeefqlalfrnrnrrnl
fadrifdvfdvkrngviefgefvrslgvfhpsapvhekvkfafklydlrqtgfiereelk
emvvallheselvlsedmievmvdkafvqadrkndgkididewkdfvslnpsliknmtlp
ylkdinrt
Timeline for d1v1fa_: