Lineage for d1tvja_ (1tvj A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210161Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2210162Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2210305Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 2210358Protein automated matches [190045] (5 species)
    not a true protein
  7. 2210364Species Chicken (Gallus gallus) [TaxId:9031] [254904] (1 PDB entry)
  8. 2210365Domain d1tvja_: 1tvj A: [240771]
    automated match to d4bex1_

Details for d1tvja_

PDB Entry: 1tvj (more details)

PDB Description: solution structure of chick cofilin
PDB Compounds: (A:) cofilin

SCOPe Domain Sequences for d1tvja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvja_ d.109.1.2 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
masgvtvndevikvfndmkvrksstpeeikkrkkavlfclsddkkqiiveeakqilvgdi
gdtvedpytafvkllplndcryalydatyetkeskkedlvfifwapesaplkskmiyass
kdaikkkftgikhewqvnglddikdrstlgeklggnvvvslegkpl

SCOPe Domain Coordinates for d1tvja_:

Click to download the PDB-style file with coordinates for d1tvja_.
(The format of our PDB-style files is described here.)

Timeline for d1tvja_: