PDB entry 1tvj

View 1tvj on RCSB PDB site
Description: Solution Structure of chick cofilin
Class: actin-binding protein
Keywords: cofilin, ADF, actin binding protein, actin depolymerizing factor, ACTIN-BINDING PROTEIN
Deposited on 2004-06-29, released 2005-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cofilin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tvja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tvjA (A:)
    masgvtvndevikvfndmkvrksstpeeikkrkkavlfclsddkkqiiveeakqilvgdi
    gdtvedpytafvkllplndcryalydatyetkeskkedlvfifwapesaplkskmiyass
    kdaikkkftgikhewqvnglddikdrstlgeklggnvvvslegkpl