Lineage for d4n6v6_ (4n6v 6:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2542784Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2542837Family d.17.1.2: Cystatins [54407] (7 proteins)
    automatically mapped to Pfam PF00031
  6. 2542905Protein automated matches [190165] (2 species)
    not a true protein
  7. 2542908Species Human (Homo sapiens) [TaxId:9606] [187953] (2 PDB entries)
  8. 2542917Domain d4n6v6_: 4n6v 6: [240580]
    automated match to d4n6v0_
    complexed with so4

Details for d4n6v6_

PDB Entry: 4n6v (more details), 1.8 Å

PDB Description: partial rotational order disorder structure of human stefin b
PDB Compounds: (6:) Cystatin-B

SCOPe Domain Sequences for d4n6v6_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n6v6_ d.17.1.2 (6:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atqpataetqhiadqvrsqleekenkkfpvfkavsfksqvvagtnyfikvhvgdedfvhl
rvfqslphenkpltlsnyqtnkakhdeltyf

SCOPe Domain Coordinates for d4n6v6_:

Click to download the PDB-style file with coordinates for d4n6v6_.
(The format of our PDB-style files is described here.)

Timeline for d4n6v6_: