Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.2: Cystatins [54407] (7 proteins) automatically mapped to Pfam PF00031 |
Protein automated matches [190165] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187953] (2 PDB entries) |
Domain d4n6v2_: 4n6v 2: [240576] automated match to d4n6v0_ complexed with so4 |
PDB Entry: 4n6v (more details), 1.8 Å
SCOPe Domain Sequences for d4n6v2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n6v2_ d.17.1.2 (2:) automated matches {Human (Homo sapiens) [TaxId: 9606]} atqpataetqhiadqvrsqleekenkkfpvfkavsfksqvvagtnyfikvhvgdedfvhl rvfqslphenkpltlsnyqtnkakhdeltyf
Timeline for d4n6v2_: