Lineage for d4lavb1 (4lav B:16-140)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2165782Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2165783Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2165784Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 protein domains)
  6. 2165883Protein FKBP52, N-terminal domains [82619] (1 species)
  7. 2165884Species Human (Homo sapiens) [TaxId:9606] [82620] (10 PDB entries)
    Uniprot Q02790 21-427; contains tandem repeat of two FKPB domains
  8. 2165892Domain d4lavb1: 4lav B:16-140 [240475]
    automated match to d4lava1
    complexed with so4

Details for d4lavb1

PDB Entry: 4lav (more details), 1.8 Å

PDB Description: Crystal Structure Analysis of FKBP52, Crystal Form II
PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase FKBP4

SCOPe Domain Sequences for d4lavb1:

Sequence, based on SEQRES records: (download)

>d4lavb1 d.26.1.1 (B:16-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
aplpmegvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdssldrkd
kfsfdlgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelf
efkge

Sequence, based on observed residues (ATOM records): (download)

>d4lavb1 d.26.1.1 (B:16-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
aplpmegvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdssldrkd
kfsfdlgkgevikawdiaiatmkvgevchitckpeyaygsagspippnatlvfevelfef
kge

SCOPe Domain Coordinates for d4lavb1:

Click to download the PDB-style file with coordinates for d4lavb1.
(The format of our PDB-style files is described here.)

Timeline for d4lavb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lavb2