SCOPe 2.08: Domain d4lavb2: 4lav B:141-255

Lineage for d4lavb2 (4lav B:141-255)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein FKBP52, N-terminal domains [82619] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82620] (11 PDB entries)
   Uniprot Q02790 21-427; contains tandem repeat of two FKPB domains

8. Domain d4lavb2: 4lav B:141-255 [240476]
   automated match to d4lava2
   complexed with so4

Details for d4lavb2

PDB Entry: 4lav, 1.8 Å

PDB Description: Crystal Structure Analysis of FKBP52, Crystal Form II

PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase FKBP4

SCOPe Domain Sequences for d4lavb2:

Sequence; same for both SEQRES and ATOM records:

>d4lavb2 d.26.1.1 (B:141-255) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
dlteeedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldl
pygleraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfeka

Timeline for d4lavb2:

• d4lavb2 first appeared in SCOPe 2.04
  
• d4lavb2 appears in SCOPe 2.07