SCOPe 2.04: Domain d1leca_: 1lec A:

Lineage for d1leca_ (1lec A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species West-central african legume (Griffonia simplicifolia) [TaxId:3850] [49907] (3 PDB entries)

8. Domain d1leca_: 1lec A: [24040]
   complexed with ca, mn, so4

Details for d1leca_

PDB Entry: 1lec, 2 Å

PDB Description: structures of the lectin iv of griffonia simplicifolia and its complex with the lewis b human blood group determinant at 2.0 angstroms resolution

PDB Compounds: (A:) west-central african legume lectin IV

SCOPe Domain Sequences for d1leca_:

Sequence; same for both SEQRES and ATOM records:

>d1leca_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]}
entvnftypdfwsyslkngteitflgdatripgalqltktdangnpvrssagqasysepv
flwdstgkaasfytsftfllknygaptadglafflapvdssvkdyggflglfrhetaadp
sknqvvavefdtwinkdwndppyphigidvnsivsvattrwenddaygssiatahityda
rskiltvllsyehgrdyilshvvdlakvlpqkvrigfsagvgydevtyilswhffstldg
tnk

Timeline for d1leca_:

• d1leca_ first appeared (with stable ids) in SCOP 1.55, called d1lec__
  
• d1leca_ appears in SCOPe 2.03
  
• d1leca_ appears in SCOPe 2.05
  
• d1leca_ appears in the current release, SCOPe 2.08