Lineage for d1lec__ (1lec -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12495Protein Lectin [49904] (15 species)
  7. 12633Species West-central african legume (Griffonia simplicifolia) [TaxId:3850] [49907] (3 PDB entries)
  8. 12636Domain d1lec__: 1lec - [24040]

Details for d1lec__

PDB Entry: 1lec (more details), 2 Å

PDB Description: structures of the lectin iv of griffonia simplicifolia and its complex with the lewis b human blood group determinant at 2.0 angstroms resolution

SCOP Domain Sequences for d1lec__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lec__ b.29.1.1 (-) Lectin {West-central african legume (Griffonia simplicifolia)}
entvnftypdfwsyslkngteitflgdatripgalqltktdangnpvrssagqasysepv
flwdstgkaasfytsftfllknygaptadglafflapvdssvkdyggflglfrhetaadp
sknqvvavefdtwinkdwndppyphigidvnsivsvattrwenddaygssiatahityda
rskiltvllsyehgrdyilshvvdlakvlpqkvrigfsagvgydevtyilswhffstldg
tnk

SCOP Domain Coordinates for d1lec__:

Click to download the PDB-style file with coordinates for d1lec__.
(The format of our PDB-style files is described here.)

Timeline for d1lec__: