Lineage for d4k67f_ (4k67 F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041245Domain d4k67f_: 4k67 F: [240393]
    Other proteins in same PDB: d4k67a1, d4k67a2, d4k67c1, d4k67c2, d4k67e1, d4k67e2, d4k67g1, d4k67g2
    automated match to d2ypgb_
    complexed with nag; mutant

Details for d4k67f_

PDB Entry: 4k67 (more details), 2.7 Å

PDB Description: structure of an airborne transmissible avian influenza h5 hemagglutinin mutant from the influenza virus a/indonesia/5/2005 complexed with human receptor analog lstc
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4k67f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k67f_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesirngtynypqyse

SCOPe Domain Coordinates for d4k67f_:

Click to download the PDB-style file with coordinates for d4k67f_.
(The format of our PDB-style files is described here.)

Timeline for d4k67f_: