Lineage for d4k67c1 (4k67 C:5-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040505Domain d4k67c1: 4k67 C:5-324 [193148]
    Other proteins in same PDB: d4k67a2, d4k67b_, d4k67c2, d4k67d_, d4k67e2, d4k67f_, d4k67g2, d4k67h_
    automated match to d2fk0a1
    complexed with nag; mutant

Details for d4k67c1

PDB Entry: 4k67 (more details), 2.7 Å

PDB Description: Structure of an airborne transmissible avian influenza H5 hemagglutinin mutant from the influenza virus A/Indonesia/5/2005 complexed with human receptor analog LSTc
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4k67c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k67c1 b.19.1.2 (C:5-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanptndlcypgsfndyeelkyllsrinhfekiqiipks
swsdheassgvssacpylgspsffrnvvwlikknsayptikksynntnqedllvlwgihh
pndaaeqtrlyqnpttyisigtstlnqrlvpkiatrskvnglssrmeffwtilkpndain
fesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrns

SCOPe Domain Coordinates for d4k67c1:

Click to download the PDB-style file with coordinates for d4k67c1.
(The format of our PDB-style files is described here.)

Timeline for d4k67c1: