![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein Influenza hemagglutinin (stalk) [58066] (22 species) trimer |
![]() | Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries) |
![]() | Domain d4k67b_: 4k67 B: [240391] Other proteins in same PDB: d4k67a1, d4k67a2, d4k67c1, d4k67c2, d4k67e1, d4k67e2, d4k67g1, d4k67g2 automated match to d2ypgb_ complexed with nag; mutant |
PDB Entry: 4k67 (more details), 2.7 Å
SCOPe Domain Sequences for d4k67b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k67b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesirngtynypqyse
Timeline for d4k67b_: