| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
| Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) |
| Protein automated matches [190133] (5 species) not a true protein |
| Species Clostridium perfringens [TaxId:1502] [234554] (6 PDB entries) |
| Domain d4h03a1: 4h03 A:0-209 [240175] Other proteins in same PDB: d4h03b1, d4h03b2 automated match to d4gy2a1 complexed with atp, ca, edo, lar, nad, po4 |
PDB Entry: 4h03 (more details), 1.75 Å
SCOPe Domain Sequences for d4h03a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h03a1 d.166.1.1 (A:0-209) automated matches {Clostridium perfringens [TaxId: 1502]}
mafierpedflkdkenaiqwekkeaerveknldtlekealelykkdseqisnysqtrqyf
ydyqiesnprekeyknlrnaisknkidkpinvyyfespekfafnkeirtenqneislekf
nelketiqdklfkqdgfkdvslyepgngdekptpllihlklpkntgmlpyinsndvktli
eqdysikidkivriviegkqyikaeasivn
Timeline for d4h03a1: