Lineage for d4h03a1 (4h03 A:1-209)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558127Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2558128Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2558129Family d.166.1.1: ADP-ribosylating toxins [56400] (10 protein domains)
  6. 2558271Protein automated matches [190133] (6 species)
    not a true protein
  7. 2558324Species Clostridium perfringens [TaxId:1502] [234554] (6 PDB entries)
  8. 2558325Domain d4h03a1: 4h03 A:1-209 [240175]
    Other proteins in same PDB: d4h03a3, d4h03b1, d4h03b2
    automated match to d4gy2a1
    complexed with atp, ca, edo, lar, nad, po4

Details for d4h03a1

PDB Entry: 4h03 (more details), 1.75 Å

PDB Description: Crystal structure of NAD+-Ia-actin complex
PDB Compounds: (A:) Iota toxin component Ia

SCOPe Domain Sequences for d4h03a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h03a1 d.166.1.1 (A:1-209) automated matches {Clostridium perfringens [TaxId: 1502]}
afierpedflkdkenaiqwekkeaerveknldtlekealelykkdseqisnysqtrqyfy
dyqiesnprekeyknlrnaisknkidkpinvyyfespekfafnkeirtenqneislekfn
elketiqdklfkqdgfkdvslyepgngdekptpllihlklpkntgmlpyinsndvktlie
qdysikidkivriviegkqyikaeasivn

SCOPe Domain Coordinates for d4h03a1:

Click to download the PDB-style file with coordinates for d4h03a1.
(The format of our PDB-style files is described here.)

Timeline for d4h03a1: