Class b: All beta proteins [48724] (180 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (14 species) not a true protein |
Species Schizosaccharomyces pombe [TaxId:284812] [189773] (4 PDB entries) |
Domain d4emho_: 4emh O: [240110] automated match to d4emhb_ |
PDB Entry: 4emh (more details), 2.2 Å
SCOPe Domain Sequences for d4emho_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4emho_ b.38.1.0 (O:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]} grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
Timeline for d4emho_: