Lineage for d4emhf_ (4emh F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787428Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2787429Protein automated matches [190914] (14 species)
    not a true protein
  7. 2787683Species Schizosaccharomyces pombe [TaxId:284812] [189773] (4 PDB entries)
  8. 2787689Domain d4emhf_: 4emh F: [234399]
    automated match to d4m78n_

Details for d4emhf_

PDB Entry: 4emh (more details), 2.2 Å

PDB Description: Crystal structure of SpLsm4
PDB Compounds: (F:) Probable U6 snRNA-associated Sm-like protein LSm4

SCOPe Domain Sequences for d4emhf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4emhf_ b.38.1.0 (F:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri

SCOPe Domain Coordinates for d4emhf_:

Click to download the PDB-style file with coordinates for d4emhf_.
(The format of our PDB-style files is described here.)

Timeline for d4emhf_: