![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein Concanavalin A [49901] (4 species) natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop |
![]() | Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (56 PDB entries) Uniprot P81461 |
![]() | Domain d1cjpd_: 1cjp D: [24001] complexed with ca, mn, mug |
PDB Entry: 1cjp (more details), 2.78 Å
SCOPe Domain Sequences for d1cjpd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjpd_ b.29.1.1 (D:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
Timeline for d1cjpd_: