SCOPe 2.04: Domain d3wdpp_: 3wdp P:

Lineage for d3wdpp_ (3wdp P:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)

6. Protein automated matches [190245] (10 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [189762] (2 PDB entries)

8. Domain d3wdpp_: 3wdp P: [239912]
   automated match to d3wdpq_
   complexed with gol, po4; mutant

Details for d3wdpp_

PDB Entry: 3wdp, 1.7 Å

PDB Description: structural analysis of a beta-glucosidase mutant derived from a hyperthermophilic tetrameric structure

PDB Compounds: (P:) Beta-glucosidase

SCOPe Domain Sequences for d3wdpp_:

Sequence; same for both SEQRES and ATOM records:

>d3wdpp_ c.1.8.4 (P:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
akfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhl
ykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikelek
ianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldekt
vvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnl
iqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkld
wigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyl
nnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaq
gfrmrfglvyvdfetkkrylrpsalvfreiatqkeipeelahladlkfvtrk

Timeline for d3wdpp_:

• d3wdpp_ is new in SCOPe 2.04-stable
  
• d3wdpp_ appears in SCOPe 2.05
  
• d3wdpp_ appears in the current release, SCOPe 2.08, called d3wdpp1