Lineage for d3wdpp1 (3wdp P:2-472)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083072Protein automated matches [190245] (11 species)
    not a true protein
  7. 2083083Species Pyrococcus furiosus [TaxId:2261] [189762] (2 PDB entries)
  8. 2083084Domain d3wdpp1: 3wdp P:2-472 [239912]
    Other proteins in same PDB: d3wdpp2, d3wdpq2, d3wdpr2, d3wdps2
    automated match to d3wdpq_
    complexed with gol, po4; mutant

Details for d3wdpp1

PDB Entry: 3wdp (more details), 1.7 Å

PDB Description: Structural analysis of a beta-glucosidase mutant derived from a hyperthermophilic tetrameric structure
PDB Compounds: (P:) Beta-glucosidase

SCOPe Domain Sequences for d3wdpp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wdpp1 c.1.8.4 (P:2-472) automated matches {Pyrococcus furiosus [TaxId: 2261]}
kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly
kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki
anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldektv
vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnli
qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw
igvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyln
nayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqg
frmrfglvyvdfetkkrylrpsalvfreiatqkeipeelahladlkfvtrk

SCOPe Domain Coordinates for d3wdpp1:

Click to download the PDB-style file with coordinates for d3wdpp1.
(The format of our PDB-style files is described here.)

Timeline for d3wdpp1: