Lineage for d3teya2 (3tey A:15-225)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1565881Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 1565882Superfamily b.179.1: PA14-like [254123] (3 families) (S)
  5. 1565883Family b.179.1.1: PA14 [254147] (2 proteins)
    Pfam PF07691
  6. 1565894Protein PA14 [254334] (1 species)
  7. 1565895Species Bacillus anthracis [254763] (14 PDB entries)
  8. 1565904Domain d3teya2: 3tey A:15-225 [239802]
    Other proteins in same PDB: d3teya1
    complexed with ca; mutant

Details for d3teya2

PDB Entry: 3tey (more details), 2.12 Å

PDB Description: Crystal Structure of Anthrax Protective Antigen (Membrane Insertion Loop Deleted) Mutant S337C N664C to 2.06-A resolution
PDB Compounds: (A:) Protective antigen

SCOPe Domain Sequences for d3teya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3teya2 b.179.1.1 (A:15-225) PA14 {Bacillus anthracis}
ssqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkks
deytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqyqrenptekgldfkl
ywtdsqnkkevissdnlqlpelkqkssnsrkkrstsagptvpdrdndgipdslevegytv
dvknkrtflspwisnihekkgltkyksspek

SCOPe Domain Coordinates for d3teya2:

Click to download the PDB-style file with coordinates for d3teya2.
(The format of our PDB-style files is described here.)

Timeline for d3teya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3teya1