| Class b: All beta proteins [48724] (176 folds) |
| Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily) core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains |
Superfamily b.179.1: PA14-like [254123] (3 families) ![]() |
| Family b.179.1.1: PA14 [254147] (2 proteins) Pfam PF07691 |
| Protein PA14 [254334] (1 species) |
| Species Bacillus anthracis [254763] (15 PDB entries) |
| Domain d3teya2: 3tey A:15-225 [239802] Other proteins in same PDB: d3teya1 complexed with ca; mutant |
PDB Entry: 3tey (more details), 2.12 Å
SCOPe Domain Sequences for d3teya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3teya2 b.179.1.1 (A:15-225) PA14 {Bacillus anthracis}
ssqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkks
deytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqyqrenptekgldfkl
ywtdsqnkkevissdnlqlpelkqkssnsrkkrstsagptvpdrdndgipdslevegytv
dvknkrtflspwisnihekkgltkyksspek
Timeline for d3teya2: