Lineage for d3texa2 (3tex A:15-225)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089592Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 2089593Superfamily b.179.1: PA14-like [254123] (3 families) (S)
  5. 2089594Family b.179.1.1: PA14 [254147] (2 proteins)
    Pfam PF07691
  6. 2089605Protein PA14 [254334] (1 species)
  7. 2089606Species Bacillus anthracis [254763] (15 PDB entries)
  8. 2089608Domain d3texa2: 3tex A:15-225 [239800]
    Other proteins in same PDB: d3texa1
    complexed with ca

Details for d3texa2

PDB Entry: 3tex (more details), 1.7 Å

PDB Description: Crystal Structure of Anthrax Protective Antigen (Membrane Insertion Loop Deleted) to 1.7-A resolution
PDB Compounds: (A:) Protective antigen

SCOPe Domain Sequences for d3texa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3texa2 b.179.1.1 (A:15-225) PA14 {Bacillus anthracis}
ssqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkks
deytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqyqrenptekgldfkl
ywtdsqnkkevissdnlqlpelkqkssnsrkkrstsagptvpdrdndgipdslevegytv
dvknkrtflspwisnihekkgltkyksspek

SCOPe Domain Coordinates for d3texa2:

Click to download the PDB-style file with coordinates for d3texa2.
(The format of our PDB-style files is described here.)

Timeline for d3texa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3texa1