SCOPe 2.08: Domain d3texa2: 3tex A:15-225

Lineage for d3texa2 (3tex A:15-225)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
   core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains

4. Superfamily b.179.1: PA14-like [254123] (4 families)

5. Family b.179.1.1: PA14 [254147] (2 proteins)
   Pfam PF07691

6. Protein PA14 [254334] (1 species)

7. Species Bacillus anthracis [254763] (15 PDB entries)

8. Domain d3texa2: 3tex A:15-225 [239800]
   Other proteins in same PDB: d3texa1
   complexed with ca

Details for d3texa2

PDB Entry: 3tex, 1.7 Å

PDB Description: Crystal Structure of Anthrax Protective Antigen (Membrane Insertion Loop Deleted) to 1.7-A resolution

PDB Compounds: (A:) Protective antigen

SCOPe Domain Sequences for d3texa2:

Sequence; same for both SEQRES and ATOM records:

>d3texa2 b.179.1.1 (A:15-225) PA14 {Bacillus anthracis}
ssqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkks
deytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqyqrenptekgldfkl
ywtdsqnkkevissdnlqlpelkqkssnsrkkrstsagptvpdrdndgipdslevegytv
dvknkrtflspwisnihekkgltkyksspek

Timeline for d3texa2:

• d3texa2 first appeared in SCOPe 2.04
  
• d3texa2 appears in SCOPe 2.07