![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.60: Anthrax protective antigen C-terminal-like [254103] (1 superfamily) C-terminal 3 domains; II (226-487) is beta-sandwiches of gamma-crystallin like topology, similar to domain I; III (488-594) has a beta-grasp like fold; IV (595-735) has an Ig-like fold |
![]() | Superfamily f.60.1: Anthrax protective antigen C-terminal-like [254122] (1 family) ![]() |
![]() | Family f.60.1.1: Anthrax protective antigen C-terminal-like [254146] (2 proteins) |
![]() | Protein Anthrax protective antigen C-terminal-like [254333] (1 species) |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [254762] (14 PDB entries) |
![]() | Domain d3tewa1: 3tew A:226-735 [239797] Other proteins in same PDB: d3tewa2 complexed with ca, mxe |
PDB Entry: 3tew (more details), 1.45 Å
SCOPe Domain Sequences for d3tewa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tewa1 f.60.1.1 (A:226-735) Anthrax protective antigen C-terminal-like {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} wstasdpysdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsq trtiskntstsrthtsepgsnsnsstvaidhslslagertwaetmglntadtarlnanir yvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapialnaqd dfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlpqiq ettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqyqgk ditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnniav gadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydmlni sslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngikkil ifskkgyeig
Timeline for d3tewa1: