PDB entry 3tew

View 3tew on RCSB PDB site
Description: Crystal Structure of Anthrax Protective Antigen (Membrane Insertion Loop Deleted) to 1.45-A resolution
Class: protein transport, toxin
Keywords: protein transport, toxin
Deposited on 2011-08-15, released 2011-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.194
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protective antigen
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BXA0164, GBAA_pXO1_0164, pag, pagA, PX01, pXO1-110
    Database cross-references and differences (RAF-indexed):
    • PDB 3TEW (Start-714)
    Domains in SCOPe 2.08: d3tewa1, d3tewa2
  • Heterogens: CA, MXE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tewA (A:)
    evkqenrllnesesssqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyf
    qsaiwsgfikvkksdeytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqy
    qrenptekgldfklywtdsqnkkevissdnlqlpelkqkssnsrkkrstsagptvpdrdn
    dgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpysdfekvt
    gridknvspearhplvaaypivhvdmeniilsknedqstqntdsqtrtiskntstsrtht
    sepgsnsnsstvaidhslslagertwaetmglntadtarlnaniryvntgtapiynvlpt
    tslvlgknqtlatikakenqlsqilapnnyypsknlapialnaqddfsstpitmnynqfl
    elektkqlrldtdqvygniatynfengrvrvdtgsnwsevlpqiqettariifngkdlnl
    verriaavnpsdplettkpdmtlkealkiafgfnepngnlqyqgkditefdfnfdqqtsq
    niknqlaelnatniytvldkiklnakmnilirdkrfhydrnniavgadesvvkeahrevi
    nssteglllnidkdirkilsgyiveiedteglkevindrydmlnisslrqdgktfidfkk
    yndklplyisnpnykvnvyavtkentiinpsengdtstngikkilifskkgyeig
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tewA (A:)
    ssqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkks
    deytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqyqrenptekgldfkl
    ywtdsqnkkevissdnlqlpelkqkssnsrkkrstsagptvpdrdndgipdslevegytv
    dvknkrtflspwisnihekkgltkyksspekwstasdpysdfekvtgridknvspearhp
    lvaaypivhvdmeniilsknedqstqntdsqtrtiskntstsrthtsepgsnsnsstvai
    dhslslagertwaetmglntadtarlnaniryvntgtapiynvlpttslvlgknqtlati
    kakenqlsqilapnnyypsknlapialnaqddfsstpitmnynqflelektkqlrldtdq
    vygniatynfengrvrvdtgsnwsevlpqiqettariifngkdlnlverriaavnpsdpl
    ettkpdmtlkealkiafgfnepngnlqyqgkditefdfnfdqqtsqniknqlaelnatni
    ytvldkiklnakmnilirdkrfhydrnniavgadesvvkeahrevinssteglllnidkd
    irkilsgyiveiedteglkevindrydmlnisslrqdgktfidfkkyndklplyisnpny
    kvnvyavtkentiinpsengdtstngikkilifskkgyeig