Class a: All alpha proteins [46456] (290 folds) |
Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily) multihelical; core: 5-helical bundle |
Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) automatically mapped to Pfam PF00621 |
Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins) Pfam PF00621 |
Protein Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF [116957] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [116958] (5 PDB entries) Uniprot O15085 714-1081 |
Domain d3t06e1: 3t06 E:714-941 [239782] Other proteins in same PDB: d3t06a2, d3t06b_, d3t06e2, d3t06f_ automated match to d3t06a1 |
PDB Entry: 3t06 (more details), 2.84 Å
SCOPe Domain Sequences for d3t06e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t06e1 a.87.1.1 (E:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} qnwqhtvgkdvvagltqreidrqevinelfvteashlrtlrvldlifyqrmkkenlmpre elarlfpnlpelieihnswceamkklreegpiikeisdlmlarfdgpareelqqvaaqfc syqsialeliktkqrkesrfqlfmqeaeshpqcrrlqlrdliisemqrltkyplllesii khteggtseheklcrardqcreilkyvneavkqtenrhrlegyqkrld
Timeline for d3t06e1:
View in 3D Domains from other chains: (mouse over for more information) d3t06a1, d3t06a2, d3t06b_, d3t06f_ |