Lineage for d3t06e1 (3t06 E:714-941)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332669Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2332670Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2332671Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. 2332699Protein Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF [116957] (1 species)
  7. 2332700Species Human (Homo sapiens) [TaxId:9606] [116958] (5 PDB entries)
    Uniprot O15085 714-1081
  8. 2332710Domain d3t06e1: 3t06 E:714-941 [239782]
    Other proteins in same PDB: d3t06a2, d3t06b_, d3t06e2, d3t06f_
    automated match to d3t06a1

Details for d3t06e1

PDB Entry: 3t06 (more details), 2.84 Å

PDB Description: crystal structure of the dh/ph fragment of pdzrhogef with n-terminal regulatory elements in complex with human rhoa
PDB Compounds: (E:) Rho guanine nucleotide exchange factor 11

SCOPe Domain Sequences for d3t06e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t06e1 a.87.1.1 (E:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}
qnwqhtvgkdvvagltqreidrqevinelfvteashlrtlrvldlifyqrmkkenlmpre
elarlfpnlpelieihnswceamkklreegpiikeisdlmlarfdgpareelqqvaaqfc
syqsialeliktkqrkesrfqlfmqeaeshpqcrrlqlrdliisemqrltkyplllesii
khteggtseheklcrardqcreilkyvneavkqtenrhrlegyqkrld

SCOPe Domain Coordinates for d3t06e1:

Click to download the PDB-style file with coordinates for d3t06e1.
(The format of our PDB-style files is described here.)

Timeline for d3t06e1: