SCOPe 2.08: Domain d3sr6a1: 3sr6 A:2-92

Lineage for d3sr6a1 (3sr6 A:2-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)

6. Protein automated matches [231466] (5 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232069] (10 PDB entries)

8. Domain d3sr6a1: 3sr6 A:2-92 [239751]
   Other proteins in same PDB: d3sr6a2, d3sr6b1, d3sr6b2, d3sr6c1, d3sr6c2, d3sr6j2, d3sr6k1, d3sr6k2, d3sr6l1, d3sr6l2
   automated match to d3etrl1
   complexed with fad, fes, mte, rmo

Details for d3sr6a1

PDB Entry: 3sr6, 2.1 Å

PDB Description: Crystal Structure of Reduced Bovine Xanthine Oxidase in Complex with Arsenite

PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3sr6a1:

Sequence; same for both SEQRES and ATOM records:

>d3sr6a1 d.15.4.2 (A:2-92) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
qdkiihfsanaclapictlhhvavttvegig

Timeline for d3sr6a1:

• d3sr6a1 first appeared in SCOPe 2.04
  
• d3sr6a1 appears in SCOPe 2.07