Lineage for d3rtjb2 (3rtj B:136-262)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401663Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2401897Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2401898Protein automated matches [226913] (9 species)
    not a true protein
  7. 2401918Species Castor bean (Ricinus communis) [TaxId:3988] [256065] (1 PDB entry)
  8. 2401920Domain d3rtjb2: 3rtj B:136-262 [239704]
    Other proteins in same PDB: d3rtja_
    automated match to d1hwob2
    protein/RNA complex

Details for d3rtjb2

PDB Entry: 3rtj (more details), 3 Å

PDB Description: crystal structure of ricin bound with dinucleotide apg
PDB Compounds: (B:) Ricin B chain

SCOPe Domain Sequences for d3rtjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rtjb2 b.42.2.0 (B:136-262) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
ntqpfvttivglyglclqansgqvwiedcssekaeqqwalyadgsirpqqnrdncltsds
niretvvkilscgpassgqrwmfkndgtilnlysglvldvrasdpslkqiilyplhgdpn
qiwlplf

SCOPe Domain Coordinates for d3rtjb2:

Click to download the PDB-style file with coordinates for d3rtjb2.
(The format of our PDB-style files is described here.)

Timeline for d3rtjb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rtjb1
View in 3D
Domains from other chains:
(mouse over for more information)
d3rtja_