SCOPe 2.07: Domain d3rtjb2: 3rtj B:136-262

Lineage for d3rtjb2 (3rtj B:136-262)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (9 species)
   not a true protein

7. Species Castor bean (Ricinus communis) [TaxId:3988] [256065] (1 PDB entry)

8. Domain d3rtjb2: 3rtj B:136-262 [239704]
   Other proteins in same PDB: d3rtja_
   automated match to d1hwob2
   protein/RNA complex

Details for d3rtjb2

PDB Entry: 3rtj, 3 Å

PDB Description: crystal structure of ricin bound with dinucleotide apg

PDB Compounds: (B:) Ricin B chain

SCOPe Domain Sequences for d3rtjb2:

Sequence; same for both SEQRES and ATOM records:

>d3rtjb2 b.42.2.0 (B:136-262) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
ntqpfvttivglyglclqansgqvwiedcssekaeqqwalyadgsirpqqnrdncltsds
niretvvkilscgpassgqrwmfkndgtilnlysglvldvrasdpslkqiilyplhgdpn
qiwlplf

Timeline for d3rtjb2:

• d3rtjb2 first appeared in SCOPe 2.04
  
• d3rtjb2 appears in SCOPe 2.06
  
• d3rtjb2 appears in the current release, SCOPe 2.08