SCOPe 2.05: Domain d3r45a_: 3r45 A:

Lineage for d3r45a_ (3r45 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193446] (28 PDB entries)

8. Domain d3r45a_: 3r45 A: [239680]
   Other proteins in same PDB: d3r45b_
   automated match to d4h9sa_
   complexed with gol, so4

Details for d3r45a_

PDB Entry: 3r45, 2.6 Å

PDB Description: Structure of a CENP-A-Histone H4 Heterodimer in complex with chaperone HJURP

PDB Compounds: (A:) Histone H3-like centromeric protein A

SCOPe Domain Sequences for d3r45a_:

Sequence; same for both SEQRES and ATOM records:

>d3r45a_ a.22.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hllirklpfsrlareicvkftrgvdfnwqaqallalqeaaeaflvhlfedaylltlhagr
vtlfpkdvqlarrirgleeglg

Timeline for d3r45a_:

• d3r45a_ first appeared in SCOPe 2.04
  
• d3r45a_ appears in SCOPe 2.06
  
• d3r45a_ appears in the current release, SCOPe 2.08