SCOPe 2.05: Domain d3r45b_: 3r45 B:

Lineage for d3r45b_ (3r45 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [192456] (11 PDB entries)

8. Domain d3r45b_: 3r45 B: [191959]
   Other proteins in same PDB: d3r45a_
   automated match to d1kx5b_
   complexed with gol, so4

Details for d3r45b_

PDB Entry: 3r45, 2.6 Å

PDB Description: Structure of a CENP-A-Histone H4 Heterodimer in complex with chaperone HJURP

PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d3r45b_:

Sequence; same for both SEQRES and ATOM records:

>d3r45b_ a.22.1.1 (B:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
rdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvt
amdvvyalkrqgrt

Timeline for d3r45b_:

• d3r45b_ first appeared in SCOPe 2.02
  
• d3r45b_ appears in SCOPe 2.04
  
• d3r45b_ appears in SCOPe 2.06
  
• d3r45b_ appears in the current release, SCOPe 2.08