Lineage for d1vlne_ (1vln E:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1532834Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1532838Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 1532854Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (56 PDB entries)
    Uniprot P81461
  8. 1532919Domain d1vlne_: 1vln E: [23967]
    complexed with ca, mn

Details for d1vlne_

PDB Entry: 1vln (more details), 2.4 Å

PDB Description: a triclinic crystal form of the lectin concanavalin a
PDB Compounds: (E:) concanavalin a

SCOPe Domain Sequences for d1vlne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlne_ b.29.1.1 (E:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d1vlne_:

Click to download the PDB-style file with coordinates for d1vlne_.
(The format of our PDB-style files is described here.)

Timeline for d1vlne_: