Lineage for d3qxee_ (3qxe E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987858Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 2987859Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 2987860Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 2987880Protein automated matches [190256] (6 species)
    not a true protein
  7. 2987887Species Pseudomonas putida [TaxId:303] [226093] (5 PDB entries)
  8. 2987894Domain d3qxee_: 3qxe E: [239658]
    Other proteins in same PDB: d3qxeb_, d3qxed_, d3qxef_, d3qxeh_
    automated match to d3qxea_
    complexed with 3co, gol

Details for d3qxee_

PDB Entry: 3qxe (more details), 2.1 Å

PDB Description: crystal structure of co-type nitrile hydratase from pseudomonas putida.
PDB Compounds: (E:) Co-type Nitrile Hydratase alpha subunit

SCOPe Domain Sequences for d3qxee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qxee_ d.149.1.1 (E:) automated matches {Pseudomonas putida [TaxId: 303]}
dhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprngakvvakaw
vdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypwptlglpp
awykaapyrsrmvsdprgvlaefglvipankeirvwdttaelrymvlperpagteaysee
qlaelvtrdsmigtglptqp

SCOPe Domain Coordinates for d3qxee_:

Click to download the PDB-style file with coordinates for d3qxee_.
(The format of our PDB-style files is described here.)

Timeline for d3qxee_: