PDB entry 3qxe

View 3qxe on RCSB PDB site
Description: Crystal Structure of Co-type Nitrile Hydratase from Pseudomonas putida.
Class: lyase
Keywords: nitrile hydratase, CO, Cobalt, Cysteine Sulfinic Acid, LYASE
Deposited on 2011-03-01, released 2011-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Co-type Nitrile Hydratase alpha subunit
    Species: Pseudomonas putida [TaxId:303]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXE
    Domains in SCOPe 2.07: d3qxea_
  • Chain 'B':
    Compound: Co-type Nitrile Hydratase beta subunit
    Species: Pseudomonas putida [TaxId:303]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXE (0-218)
    Domains in SCOPe 2.07: d3qxeb_
  • Chain 'C':
    Compound: Co-type Nitrile Hydratase alpha subunit
    Species: Pseudomonas putida [TaxId:303]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXE
    Domains in SCOPe 2.07: d3qxec_
  • Chain 'D':
    Compound: Co-type Nitrile Hydratase beta subunit
    Species: Pseudomonas putida [TaxId:303]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXE (0-218)
    Domains in SCOPe 2.07: d3qxed_
  • Chain 'E':
    Compound: Co-type Nitrile Hydratase alpha subunit
    Species: Pseudomonas putida [TaxId:303]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXE
    Domains in SCOPe 2.07: d3qxee_
  • Chain 'F':
    Compound: Co-type Nitrile Hydratase beta subunit
    Species: Pseudomonas putida [TaxId:303]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXE (0-218)
    Domains in SCOPe 2.07: d3qxef_
  • Chain 'G':
    Compound: Co-type Nitrile Hydratase alpha subunit
    Species: Pseudomonas putida [TaxId:303]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXE
    Domains in SCOPe 2.07: d3qxeg_
  • Chain 'H':
    Compound: Co-type Nitrile Hydratase beta subunit
    Species: Pseudomonas putida [TaxId:303]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXE (0-218)
    Domains in SCOPe 2.07: d3qxeh_
  • Heterogens: 3CO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qxeA (A:)
    asmtggqqmgrgsefmgqshthdhhhdgyqappedialrvkaleslliekglvdpaamdl
    vvqtyehkvgprngakvvakawvdpaykarlladgtagiaelgfsgvqgedmvilentpa
    vhnvfvctlcscypwptlglppawykaapyrsrmvsdprgvlaefglvipankeirvwdt
    taelrymvlperpagteayseeqlaelvtrdsmigtglptqptpsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qxeA (A:)
    hdhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprngakvvaka
    wvdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypwptlglp
    pawykaapyrsrmvsdprgvlaefglvipankeirvwdttaelrymvlperpagteayse
    eqlaelvtrdsmigtglptqp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qxeB (B:)
    mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiermgp
    ahylegtyyehwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas
    aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge
    hpqhvytvsftsvelwgqdasspkdtirvdlwddylepa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qxeC (C:)
    asmtggqqmgrgsefmgqshthdhhhdgyqappedialrvkaleslliekglvdpaamdl
    vvqtyehkvgprngakvvakawvdpaykarlladgtagiaelgfsgvqgedmvilentpa
    vhnvfvctlcscypwptlglppawykaapyrsrmvsdprgvlaefglvipankeirvwdt
    taelrymvlperpagteayseeqlaelvtrdsmigtglptqptpsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qxeC (C:)
    hdhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprngakvvaka
    wvdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypwptlglp
    pawykaapyrsrmvsdprgvlaefglvipankeirvwdttaelrymvlperpagteayse
    eqlaelvtrdsmigtglptqp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qxeD (D:)
    mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiermgp
    ahylegtyyehwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas
    aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge
    hpqhvytvsftsvelwgqdasspkdtirvdlwddylepa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3qxeE (E:)
    asmtggqqmgrgsefmgqshthdhhhdgyqappedialrvkaleslliekglvdpaamdl
    vvqtyehkvgprngakvvakawvdpaykarlladgtagiaelgfsgvqgedmvilentpa
    vhnvfvctlcscypwptlglppawykaapyrsrmvsdprgvlaefglvipankeirvwdt
    taelrymvlperpagteayseeqlaelvtrdsmigtglptqptpsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qxeE (E:)
    dhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprngakvvakaw
    vdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypwptlglpp
    awykaapyrsrmvsdprgvlaefglvipankeirvwdttaelrymvlperpagteaysee
    qlaelvtrdsmigtglptqp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qxeF (F:)
    mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiermgp
    ahylegtyyehwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas
    aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge
    hpqhvytvsftsvelwgqdasspkdtirvdlwddylepa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3qxeG (G:)
    asmtggqqmgrgsefmgqshthdhhhdgyqappedialrvkaleslliekglvdpaamdl
    vvqtyehkvgprngakvvakawvdpaykarlladgtagiaelgfsgvqgedmvilentpa
    vhnvfvctlcscypwptlglppawykaapyrsrmvsdprgvlaefglvipankeirvwdt
    taelrymvlperpagteayseeqlaelvtrdsmigtglptqptpsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qxeG (G:)
    dhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprngakvvakaw
    vdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypwptlglpp
    awykaapyrsrmvsdprgvlaefglvipankeirvwdttaelrymvlperpagteaysee
    qlaelvtrdsmigtglptqp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qxeH (H:)
    mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiermgp
    ahylegtyyehwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas
    aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge
    hpqhvytvsftsvelwgqdasspkdtirvdlwddylepa