Lineage for d3qxec_ (3qxe C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548277Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 2548278Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 2548279Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 2548299Protein automated matches [190256] (6 species)
    not a true protein
  7. 2548306Species Pseudomonas putida [TaxId:303] [226093] (5 PDB entries)
  8. 2548312Domain d3qxec_: 3qxe C: [239657]
    Other proteins in same PDB: d3qxeb_, d3qxed_, d3qxef_, d3qxeh_
    automated match to d3qxea_
    complexed with 3co, gol

Details for d3qxec_

PDB Entry: 3qxe (more details), 2.1 Å

PDB Description: crystal structure of co-type nitrile hydratase from pseudomonas putida.
PDB Compounds: (C:) Co-type Nitrile Hydratase alpha subunit

SCOPe Domain Sequences for d3qxec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qxec_ d.149.1.1 (C:) automated matches {Pseudomonas putida [TaxId: 303]}
hdhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprngakvvaka
wvdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypwptlglp
pawykaapyrsrmvsdprgvlaefglvipankeirvwdttaelrymvlperpagteayse
eqlaelvtrdsmigtglptqp

SCOPe Domain Coordinates for d3qxec_:

Click to download the PDB-style file with coordinates for d3qxec_.
(The format of our PDB-style files is described here.)

Timeline for d3qxec_: