Lineage for d3pvwa3 (3pvw A:550-668)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2061578Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 protein domains)
    Pfam PF00169
  6. 2061658Protein G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) [50747] (2 species)
  7. 2061659Species Cow (Bos taurus) [TaxId:9913] [89354] (6 PDB entries)
  8. 2061662Domain d3pvwa3: 3pvw A:550-668 [239630]
    Other proteins in same PDB: d3pvwa1, d3pvwa2, d3pvwb_, d3pvwg_
    automated match to d1omwa2
    complexed with qrx

Details for d3pvwa3

PDB Entry: 3pvw (more details), 2.49 Å

PDB Description: Bovine GRK2 in complex with Gbetagamma subunits and a selective kinase inhibitor (CMPD103A)
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d3pvwa3:

Sequence, based on SEQRES records: (download)

>d3pvwa3 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

Sequence, based on observed residues (ATOM records): (download)

>d3pvwa3 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]}
eedyalgkdcimhgymskmgwqrryfylfpnrlewrgegeapqslltmeeiqsveetqik
erkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

SCOPe Domain Coordinates for d3pvwa3:

Click to download the PDB-style file with coordinates for d3pvwa3.
(The format of our PDB-style files is described here.)

Timeline for d3pvwa3: